RORA anticorps (Middle Region)

N° du produit ABIN629579

L’anticorps Lapin Polyclonal anti-RORA a été validé pour WB et IHC. Il convient pour détecter RORA dans des échantillons de Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour RORA anticorps (Middle Region) (ABIN629579)

Antigène: RORA (RAR-Related Orphan Receptor A (RORA))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RORA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RORA anticorps

Épitope: Middle Region

Specificité: RORA antibody was raised against the middle region of RORA

Purification: Purified

Immunogène: RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RORA Blocking Peptide, (ABIN938702), is also available for use as a blocking control in assays to test for specificity of this RORA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RORA

Antigène: RORA (RAR-Related Orphan Receptor A (RORA))

Autre désignation: RORA

Sujet: The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha